PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400010074
Common NameBRC1A, STBRC1A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family TCP
Protein Properties Length: 215aa    MW: 24141 Da    PI: 9.7002
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400010074genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP94.52.2e-29112922136
                   TCP  22 vRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt................ssssaseceaesssssasnsssgkaaksa 94 
                           +Rls+e+a++fF Lqd LGfdk+skt+eWLl+++k a+ +l++                  ss++++ce  s +  +s+ +  ++  ++
  PGSC0003DMP400010074   1 MRLSLEIARKFFNLQDLLGFDKASKTVEWLLTKSKSAVNDLVQKiskgkcsastnpnigvVSSPSESCEVISGVIDESAAT--NNTHKQ 87 
                           8*******************************************8887776655555555333334553333333333222..222222 PP

                   TCP  95 akskksqksaasalnlakesrakarararertrekmriknkl 136
                           +k+kks ++a  +  +akesr +arararert+ k++++n++
  PGSC0003DMP400010074  88 QKKKKSIRRAIFHPVVAKESRTEARARARERTKIKKSLNNNN 129
                           344444444445688999***************999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-291123IPR005333Transcription factor, TCP
PROSITE profilePS5136924.88141IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.331105122IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MRLSLEIARK FFNLQDLLGF DKASKTVEWL LTKSKSAVND LVQKISKGKC SASTNPNIGV  60
VSSPSESCEV ISGVIDESAA TNNTHKQQKK KKSIRRAIFH PVVAKESRTE ARARARERTK  120
IKKSLNNNNG DQSMAPDEDL TRSLGSWSTT FEDHQSGIQA YNNTNNIMNA VDNFNLVDTS  180
NWSPFMFNYH QINTEISQEH QLTNFQYPGK LWEA*
Function -- GeneRIF ? help Back to Top
  1. A Recently Evolved Alternative Splice Site in the BRANCHED1a Gene Controls Potato Plant Architecture.
    [PMID: 26119747]
  2. The BRC1a(Long) C-terminal region has a strong activation domain, whereas that of BRC1a(Short) lacks an activation domain and is predicted to form an amphipathic helix, the H domain, which prevents protein nuclear targeting.
    [PMID: 26119747]
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM5972260.0HM597226.1 Solanum tuberosum BRANCHED1A isoform 1 (BRC1A) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006341644.11e-158PREDICTED: transcription factor BRC1a isoform X1
TrEMBLF6KB941e-158F6KB94_SOLTU; BRANCHED1A isoform 1
TrEMBLM1A4H41e-160M1A4H4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000145721e-143(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18550.13e-17TCP family protein
Publications ? help Back to Top
  1. Mart
    Role of tomato BRANCHED1-like genes in the control of shoot branching.
    Plant J., 2011. 67(4): p. 701-14
    [PMID:21554455]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Nicolas M,Rodr
    A Recently Evolved Alternative Splice Site in the BRANCHED1a Gene Controls Potato Plant Architecture.
    Curr. Biol., 2015. 25(14): p. 1799-809
    [PMID:26119747]